Skip to product information
1 of 3

TGF beta 1 is a protein that plays an important role in many biological processes. It is an important regulator of cell growth and differentiation, which is particularly relevant in medical research. Our TGF Beta 1 solutions are highly purified and of the highest quality, making them ideal for research.

Protein: pro-TGF-beta 1, His-tag

Protein: pro-TGF-beta 1, His-tag

Regular price €1.950,00 EUR
Regular price €4.495,00 EUR Sale price €1.950,00 EUR
Unit price €1.950,00  per  mg
Sale Sold out
Tax included.

pro-TGF-beta 1, His-tag is a recombinant protein designed to facilitate research in the field of Transforming Growth Factor beta 1 (TGF-beta 1). This His-tagged protein offers excellent solubility in a variety of buffers for both in vitro and in vivo applications.

Protein: pro-TGF-beta 1, His-tag (~ 44.9 kDa) 

Uniprot#: P01137

Sequence: MELVKRKRIEAIRGQILSKLRLASPPSQGEVPPG

PLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSI

YMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSD

SPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIH

GMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWI

HEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVG

RKPKVEQLSNMIVRSCKCS


Methionine at pos. 1 present due to cloning constraints, N-terminal His-tag
not shown in sequence.

Source: Recombinantly expressed in HEK293 cells.

Tag(s): His-tag, N-terminal

Purification: Purified by affinity chromatography and subsequent buffer exchange.

Formulation: PBS; pH 7.4.

Liquid, stored and shipped at -80 °C.

Purity: > 95 % (will be determined by densitometry of Coomassie stained gel, example next page)

Concentration: Will be determined by BCA-Assay.

Long-term storage: No recommendations.

Comment: Pro-TGF-beta 1 consists of the latency associated peptide (LAP) and the mature transforming growth factor (TGF)-beta 1 together forming the small latent complex (SLC). This results in three distinct protein bands in SDS-PAGE as illustrated on page 2.
View full details